PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI07G00610.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 267aa    MW: 30433.8 Da    PI: 9.6463
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI07G00610.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.94.2e-31959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gklyey++
  ORUFI07G00610.2  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYAT 59
                     79***********************************************86 PP

2K-box109.83.1e-3678173499
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                      +   s+e++ + ++++e++kLk++ie++q+ ++hl+GedLesL+lkeLqqLeqqLe+slk+iRs+K++l+le+i+elqkke++lqeenkaL+k+
  ORUFI07G00610.2  78 KALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIRSRKSHLMLESISELQKKERSLQEENKALQKE 171
                      556667888899********************************************************************************99 PP

            K-box  98 le 99 
                      l 
  ORUFI07G00610.2 172 LV 173
                      86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-35288IPR002100Transcription factor, MADS-box
CDDcd002655.06E-42276No hitNo description
PRINTSPR004041.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-3084172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.61688178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP KGKLYEYATD  60
SRMDKILERY ERYSYAEKAL ISAESESEGN WCHEYRKLKA KIETIQKCHK HLMGEDLESL  120
NLKELQQLEQ QLESSLKHIR SRKSHLMLES ISELQKKERS LQEENKALQK ELVERQKNVR  180
GQQQVGQWDQ TQVQAQAQAQ PQAQTSSSSS SMLRDQQALL PPQNICYPPV MMGERNDAAA  240
AAAVAAQGQV QLRIGGLPPW MLSHLNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q7e-22174173Myocyte-specific enhancer factor 2B
1tqe_R7e-22174173Myocyte-specific enhancer factor 2B
1tqe_S7e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033250.0AB003325.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31864.
GenBankAY5519200.0AY551920.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS215 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645259.10.0PREDICTED: MADS-box transcription factor 15 isoform X2
SwissprotQ6Q9I20.0MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLA0A0E0E6U80.0A0A0E0E6U8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0Q3850.0A0A0E0Q385_ORYRU; Uncharacterized protein
STRINGBGIOSGA024961-PA1e-154(Oryza sativa Indica Group)
STRINGLOC_Os07g01820.11e-154(Oryza sativa Japonica Group)
STRINGOB07G10630.11e-155(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-73MIKC_MADS family protein